PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01405.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 318aa    MW: 36079.6 Da    PI: 7.6623
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01405.1_g00015.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.7e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
  Rsa1.0_01405.1_g00015.1 14 KGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding53.36.2e-1767112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Rsa1.0_01405.1_g00015.1  67 RGKFSVQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.904961IPR017930Myb domain
SuperFamilySSF466891.1E-3011108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002496.0E-171461IPR001005SANT/Myb domain
CDDcd001672.92E-111661No hitNo description
PROSITE profilePS5129426.31162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2665117IPR009057Homeodomain-like
SMARTSM007175.3E-1766114IPR001005SANT/Myb domain
PfamPF002492.9E-1667112IPR001005SANT/Myb domain
CDDcd001673.13E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRSPCCDKD GLKKGPWTPE EDQKLLAYIE EHGHGSWRSL PEKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SVQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLVKMG  120
IDPVTHKHKN ETLLSSTGQS NKNLATLSHM AQWESARLEA EARLARESKL LHLQHYQNKK  180
AAAPSLCLTH KASTNWTKPN EGMGDHQLLE SPTSTVTFSE NLPPMIMHLG IPTGNRNSRV  240
AVSSEHDDWM RQINCPEEGI EEGFTSLLLS DSVDRSLSAG KNAVEVNESE YSYYEDNKNY  300
WNTILNLVDS SPSDDVLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667330.0KC966733.1 Brassica napus MYB transcription factor 106 (MYB106.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013584217.10.0PREDICTED: myb-related protein Hv1
TrEMBLA0A0D3CNG70.0A0A0D3CNG7_BRAOL; Uncharacterized protein
STRINGBra039142.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.11e-148myb domain protein 106